Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHMP4B Peptide - middle region

CHMP4B Peptide - middle region

Product Specifications

Product Name Alternative

C20orf178, CHMP4A, CTPP3, SNF7, SNF7-2, Shax1, dJ553F4.4, VPS32B, Vps32-2

UniProt

Q9H444

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHMP4B Rabbit Polyclonal Antibody (orb582036) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_789782

Preservative

Lyophilized powder

AA Sequence

RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brain Derived Acidic Fibroblast Growth Factor Peptide
abx265458-01 5 mg

Brain Derived Acidic Fibroblast Growth Factor Peptide

Sign In for Pricing
View Details
Brain Derived Acidic Fibroblast Growth Factor Peptide
abx265458-02 10 mg

Brain Derived Acidic Fibroblast Growth Factor Peptide

Sign In for Pricing
View Details
Brain Derived Acidic Fibroblast Growth Factor Peptide
abx265458-03 25 mg

Brain Derived Acidic Fibroblast Growth Factor Peptide

Sign In for Pricing
View Details
PLX304-JOSD1-V5-Blast Plasmid
PVT70180 2 µg

PLX304-JOSD1-V5-Blast Plasmid

Sign In for Pricing
View Details
Recombinant human Mannose-binding protein C
OPCA01272-20UG 20 µg

Recombinant human Mannose-binding protein C

Sign In for Pricing
View Details
APOA2 Rabbit pAb, PE-Cy7 conjugated
orb2822209 100 µL

APOA2 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details