Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant human Mannose-binding protein C

Product Specifications

CAS Number

9000-83-3

Gene Name

Mannose binding lectin 2

Gene Aliases

COLEC1; collectin-1; HSMBPC; mannan-binding lectin; Mannan-binding protein; Mannose-binding lectin; mannose-binding lectin (protein C) 2, soluble (opsonic defect) ; mannose-binding lectin 2, soluble (opsonic defect) ; mannose-binding protein C; MBL; MBL2D; MBP; MBP1; MBP-C; MBPD.

Gene ID

4153

Reactivity

Homo sapiens|Human

Target

Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.

Type

Protein

Source

Yeast

Sequence

ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

26 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MBL2

Protein Name

Mannose-binding protein C

Gene Name URL

MBL2

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMSA (FOLH1) - CHO Recombinant Cell Line (Low Expression)
79641-L 2 vials

PMSA (FOLH1) - CHO Recombinant Cell Line (Low Expression)

Sign In for Pricing
View Details
Baricitinib Impurity 9
RM-B180309-01 10 mg

Baricitinib Impurity 9

Sign In for Pricing
View Details
Baricitinib Impurity 9
RM-B180309-02 25 mg

Baricitinib Impurity 9

Sign In for Pricing
View Details
Baricitinib Impurity 9
RM-B180309-03 50 mg

Baricitinib Impurity 9

Sign In for Pricing
View Details
Baricitinib Impurity 9
RM-B180309-04 100 mg

Baricitinib Impurity 9

Sign In for Pricing
View Details
GNAS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV688549 1.0 µg DNA

GNAS Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details