Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coro2b Peptide - C-terminal region

Coro2b Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLIPINC, E130012P22Rik

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Coro2b Rabbit Polyclonal Antibody (orb581586) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780693

Preservative

Lyophilized powder

AA Sequence

FPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AAS Manganese Std 1ppm in 2% HNO3 - 100ML
AAMNE 100 mL

AAS Manganese Std 1ppm in 2% HNO3 - 100ML

Sign In for Pricing
View Details
Mouse Monoclonal VSIG8 Antibody (961823) [DyLight 405]
FAB9418E 0.1 mL

Mouse Monoclonal VSIG8 Antibody (961823) [DyLight 405]

Sign In for Pricing
View Details
CRABP2 Mouse mAb
E2M50069 100 µL

CRABP2 Mouse mAb

Sign In for Pricing
View Details
Anti-GRIM19 Rabbit pAb
GB112555 100 μL

Anti-GRIM19 Rabbit pAb

Sign In for Pricing
View Details
FOXO4 AAV siRNA Pooled Vector
20792161 1.0 µg

FOXO4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse SLC16A3 shRNA Plasmid
abx979052-01 150 µg

Mouse SLC16A3 shRNA Plasmid

Sign In for Pricing
View Details