Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coro2b Peptide - C-terminal region

Coro2b Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLIPINC, E130012P22Rik

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Coro2b Rabbit Polyclonal Antibody (orb581586) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780693

Preservative

Lyophilized powder

AA Sequence

FPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BPIFC Peptide - C-terminal region
orb2000220 100 µg

BPIFC Peptide - C-terminal region

Sign In for Pricing
View Details
Lentiviral human KTN1 sgRNA gene knockout kit - Lentiviral human KTN1 sgRNA gene knockout kit (100)
GTR15362719 1 Vial

Lentiviral human KTN1 sgRNA gene knockout kit - Lentiviral human KTN1 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Nitrate Reductase Assay Kit (Visible Spectrophotometry)
CB0164V 50 Tests

Nitrate Reductase Assay Kit (Visible Spectrophotometry)

Sign In for Pricing
View Details
Recombinant Human MAGB6 (FLAG)
BP3840-50ug 50 µg

Recombinant Human MAGB6 (FLAG)

Sign In for Pricing
View Details
Hsa-miR-4723-5p miRNA Antagomir
CIJ1571-01 10 nmol

Hsa-miR-4723-5p miRNA Antagomir

Sign In for Pricing
View Details
Hsa-miR-4723-5p miRNA Antagomir
CIJ1571-02 20 nmol

Hsa-miR-4723-5p miRNA Antagomir

Sign In for Pricing
View Details