Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Coro2b Peptide - C-terminal region

Coro2b Peptide - C-terminal region

Product Specifications

Product Name Alternative

CLIPINC, E130012P22Rik

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Coro2b Rabbit Polyclonal Antibody (orb581586) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_780693

Preservative

Lyophilized powder

AA Sequence

FPFYDADTHMLYLAGKGDGNIRYYEISTEKPYLSYLMEFRSPAPQKGLGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc25a5 ORF Vector (Mouse) (pORF)
ORF057579 1.0 µg DNA

Slc25a5 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
RAF1, phosphorylated (Ser338) (RAF Proto-oncogene Serine/Threonine-protein Kinase, Proto-oncogene c-RAF, Raf-1, C-RAF, cRaf, RAF) (MaxLight 490) discontinued
R0495-09W1-ML490 100 µL

RAF1, phosphorylated (Ser338) (RAF Proto-oncogene Serine/Threonine-protein Kinase, Proto-oncogene c-RAF, Raf-1, C-RAF, cRaf, RAF) (MaxLight 490) discontinued

Sign In for Pricing
View Details
10058-F4
sc-213577A 25 mg

10058-F4

Sign In for Pricing
View Details
LYPD1 siRNA (Human)
MBS8207520-01 15 nmol

LYPD1 siRNA (Human)

Sign In for Pricing
View Details
LYPD1 siRNA (Human)
MBS8207520-02 30 nmol

LYPD1 siRNA (Human)

Sign In for Pricing
View Details
LYPD1 siRNA (Human)
MBS8207520-03 5x 30 nmol

LYPD1 siRNA (Human)

Sign In for Pricing
View Details