BPIFC Peptide - C-terminal region
BPIFC Peptide - C-terminal region
Product Specifications
Product Name Alternative
BPIL2
UniProt
Q8NFQ6
Field of Research
Immunology & Inflammation
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with BPIFC Rabbit Polyclonal Antibody (orb589526) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_777592.1
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: FVNSDIEVLEGFLLISTDLKYETSSKQQPSFHVWEGLNLISRQWRGKSAP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC208156L2V 200 µL
CDH12 (NM_004061) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details abx034702-01 80 µL
Transcription Initiation Factor TFIID Subunit 7-Like (TAF7L) Antibody
Sign In for Pricing
View Details abx034702-02 400 µL
Transcription Initiation Factor TFIID Subunit 7-Like (TAF7L) Antibody
Sign In for Pricing
View Details 
C0005-60A 100 µg
CCDC6 (Coiled-coil Domain Containing 6, Coiled-coil Domain-containing Protein 6, D10S170, FLJ32286, H4, Papillary Thyroid Carcinoma-encoded Protein, PTC, Protein H4, TPC, TST1)
Sign In for Pricing
View Details