CPNE3 Peptide - C-terminal region
CPNE3 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CPN3, KIAA0636, PRO1071
UniProt
Q9NVH1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CPNE3 Rabbit Polyclonal Antibody (orb585361) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_060668
Preservative
Lyophilized powder
AA Sequence
QFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPKNPATKQQKQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
042775-AP 200 µL
TG3, cleaved (APG3, APG3-LIKE, APG3L, DKFZp564M1178, FLJ22125, MGC15201, PC3-96, 2610016C12Rik, APG3 autophagy 3-like, autophagy Apg3p/Aut1p-like, autophagy-related protein 3, hApg3) (AP) discontinued
Sign In for Pricing
View Details ARP65342_P050-FITC 100 µL
MATN4 Antibody - N-terminal region : FITC (ARP65342_P050-FITC)
Sign In for Pricing
View Details 
MBS9938373 Inquire
Rabbit AP2-Associated Protein Kinase 1 (AAK1) ELISA Kit
Sign In for Pricing
View Details