Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RERG Peptide - C-terminal region

RERG Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC15754

UniProt

Q96A58

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RERG Rabbit Polyclonal Antibody (orb584414) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116307

Preservative

Lyophilized powder

AA Sequence

PPREEFNFSVGFKDLNESLNALEDQDLDALMADLVADISEAEQRTIQAQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lysozyme (LZM) Antibody
abx173413 1 mL

Lysozyme (LZM) Antibody

Sign In for Pricing
View Details
HNF4A Recombinant Antibody [10A7] (OACA12592)
OACA12592-100UL 100 µL

HNF4A Recombinant Antibody [10A7] (OACA12592)

Sign In for Pricing
View Details
Biotin-Linked Anti-Profilin 3 (PFN3)
FY-AB41372-01 1 mL

Biotin-Linked Anti-Profilin 3 (PFN3)

Sign In for Pricing
View Details
Biotin-Linked Anti-Profilin 3 (PFN3)
FY-AB41372-02 100 µL

Biotin-Linked Anti-Profilin 3 (PFN3)

Sign In for Pricing
View Details
Biotin-Linked Anti-Profilin 3 (PFN3)
FY-AB41372-03 200 µL

Biotin-Linked Anti-Profilin 3 (PFN3)

Sign In for Pricing
View Details
Rabbit Monoclonal ECM-1/Secretory Component P85 Antibody (030) [mFluor Violet 500 SE]
NBP2-89452MFV500 0.1 mL

Rabbit Monoclonal ECM-1/Secretory Component P85 Antibody (030) [mFluor Violet 500 SE]

Sign In for Pricing
View Details