Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNND1 Peptide - middle region

CTNND1 Peptide - middle region

Product Specifications

Product Name Alternative

CAS, CTNND, KIAA0384, P120CAS, P120CTN, p120, p120 (CAS), p120 (CTN)

UniProt

O60716

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTNND1 Rabbit Polyclonal Antibody (orb330649) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001078927

Preservative

Lyophilized powder

AA Sequence

QTIWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA Gyrase-IN-12
HY-169105 1 Each

DNA Gyrase-IN-12

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: sigmoid
CS520388 5x 5 µm

Frozen Tissue Sections, Colon: sigmoid

Sign In for Pricing
View Details
CD22 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]
TA807826AM 100 µL

CD22 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2E6]

Sign In for Pricing
View Details
Recombinant Macaca fascicularis HORMA domain-containing protein 1 (HORMAD1)
MBS1286274-01 0.02 mg (E-Coli)

Recombinant Macaca fascicularis HORMA domain-containing protein 1 (HORMAD1)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis HORMA domain-containing protein 1 (HORMAD1)
MBS1286274-02 0.02 mg (Yeast)

Recombinant Macaca fascicularis HORMA domain-containing protein 1 (HORMAD1)

Sign In for Pricing
View Details
Recombinant Macaca fascicularis HORMA domain-containing protein 1 (HORMAD1)
MBS1286274-03 0.1 mg (E-Coli)

Recombinant Macaca fascicularis HORMA domain-containing protein 1 (HORMAD1)

Sign In for Pricing
View Details