Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTRB1 Peptide - middle region

CTRB1 Peptide - middle region

Product Specifications

Product Name Alternative

CTRB, FLJ42412, MGC88037

UniProt

P17538

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTRB1 Rabbit Polyclonal Antibody (orb574843) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001897

Preservative

Lyophilized powder

AA Sequence

VTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Scube3 Mouse shRNA Plasmid (Locus ID 268935)
TR510503 1 Kit

Scube3 Mouse shRNA Plasmid (Locus ID 268935)

Sign In for Pricing
View Details
RERE Rabbit Polyclonal Antibody (Cy3)
orb2580750 100 µg

RERE Rabbit Polyclonal Antibody (Cy3)

Sign In for Pricing
View Details
RNF111 Antibody
59-964 400 µL

RNF111 Antibody

Sign In for Pricing
View Details
TRIM11 Antibody
orb1248775 0.1 mg

TRIM11 Antibody

Sign In for Pricing
View Details
Phospho-STAT1 (Ser727) Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-3427R-APC-Cy5.5 100 µL

Phospho-STAT1 (Ser727) Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Ltb4r2 siRNA Oligos set (Mouse)
27766174 3x 5 nmol

Ltb4r2 siRNA Oligos set (Mouse)

Sign In for Pricing
View Details