Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CUTA Peptide - middle region

CUTA Peptide - middle region

Product Specifications

Product Name Alternative

ACHAP, C6orf82, MGC111154

UniProt

O60888

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CUTA Rabbit Polyclonal Antibody (orb579246) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001014840

Preservative

Lyophilized powder

AA Sequence

AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Arabidopsis thaliana Potassium channel KAT2 (KAT2)
MBS7017592-01 0.02 mg

Recombinant Arabidopsis thaliana Potassium channel KAT2 (KAT2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Potassium channel KAT2 (KAT2)
MBS7017592-02 0.1 mg

Recombinant Arabidopsis thaliana Potassium channel KAT2 (KAT2)

Sign In for Pricing
View Details
Recombinant Arabidopsis thaliana Potassium channel KAT2 (KAT2)
MBS7017592-03 5x 0.1 mg

Recombinant Arabidopsis thaliana Potassium channel KAT2 (KAT2)

Sign In for Pricing
View Details
Anti-Choline Acetyltransferase (ChAT) Antibody
CAT-0020 100 µL

Anti-Choline Acetyltransferase (ChAT) Antibody

Sign In for Pricing
View Details
SMOC2 Antibody
A47771-100UL 100 µL

SMOC2 Antibody

Sign In for Pricing
View Details
Recombinant Drosophila melanogaster General odorant-binding protein lush (lush)
CSB-EP517298DLU-01 20 µg

Recombinant Drosophila melanogaster General odorant-binding protein lush (lush)

Sign In for Pricing
View Details