Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dag1 Peptide - C-terminal region

Dag1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

D9Wsu13e, DG, Dp427, Dp71

UniProt

Q62165

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dag1 Rabbit Polyclonal Antibody (orb330487) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034147

Preservative

Lyophilized powder

AA Sequence

PPSPGSSAAPATEVPDRDPEKSSEDDVYLHTVIPAVVVAAILLIAGIIAM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-LINGO2 Antibody Picoband® Fluoro647 Conjugated
A12658-1-Fluoro647 100 µg/Vial

Anti-LINGO2 Antibody Picoband® Fluoro647 Conjugated

Sign In for Pricing
View Details
Recombinant Rhodobacter sphaeroides NADH-quinone oxidoreductase subunit K (nuoK)
orb2934764-01 20 µg

Recombinant Rhodobacter sphaeroides NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
Recombinant Rhodobacter sphaeroides NADH-quinone oxidoreductase subunit K (nuoK)
orb2934764-02 100 µg

Recombinant Rhodobacter sphaeroides NADH-quinone oxidoreductase subunit K (nuoK)

Sign In for Pricing
View Details
L-Serine-d7
TRC-S271006-10MG 10 mg

L-Serine-d7

Sign In for Pricing
View Details
FDU73
HY-173125 1 Each

FDU73

Sign In for Pricing
View Details
Mouse Monoclonal Biotin (Vitamin B7 or Vitamin H) Antibody (BTN/403) [mFluor Violet 500 SE]
NBP3-14087MFV500 0.1 mL

Mouse Monoclonal Biotin (Vitamin B7 or Vitamin H) Antibody (BTN/403) [mFluor Violet 500 SE]

Sign In for Pricing
View Details