Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DEPDC1 Peptide - middle region

DEPDC1 Peptide - middle region

Product Specifications

Product Name Alternative

DEP.8, DEPDC1-V2, DEPDC1A, FLJ20354, SDP35

UniProt

Q5TB30

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DEPDC1 Rabbit Polyclonal Antibody (orb583101) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001107592

Preservative

Lyophilized powder

AA Sequence

PEPLLTFEYYELFVNILVVCGYITVSDRSSGIHKIQDDPQSSKFLHLNNL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNPO3 Human Gene Knockout Kit (CRISPR)
KN423103 1 Kit

TNPO3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
iFluor™ 488 Conjugated BRG1 Recombinant Rabbit Monoclonal Antibody [SN20-03]
HA720177F 100 µL

iFluor™ 488 Conjugated BRG1 Recombinant Rabbit Monoclonal Antibody [SN20-03]

Sign In for Pricing
View Details
EIF4B (Ab-422) Antibody
8B0641-AAT 50 µg

EIF4B (Ab-422) Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Urinary bladder
CS708011 5x 5 µm

Tissue FFPE Sections, Urinary bladder

Sign In for Pricing
View Details
Tissue Genomic DNA, Breast
CD565301 5 µg

Tissue Genomic DNA, Breast

Sign In for Pricing
View Details
Zmat2 (NM_025594) Mouse Tagged ORF Clone
MG201998 10 µg

Zmat2 (NM_025594) Mouse Tagged ORF Clone

Sign In for Pricing
View Details