Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dnajb12 Peptide - N-terminal region

Dnajb12 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Dj10, mDj10

UniProt

Q8K037

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Dnajb12 Rabbit Polyclonal Antibody (orb576265) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064349

Preservative

Lyophilized powder

AA Sequence

NQKPQSTGDHPQPTDTTHTTTKKAGGTETPSANGEAGGGESAKGYTSEQV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human C5a (Complement Component 5a) CLIA Kit
E-CL-H0174-01 24 Tests

Human C5a (Complement Component 5a) CLIA Kit

Sign In for Pricing
View Details
Human C5a (Complement Component 5a) CLIA Kit
E-CL-H0174-02 48 Tests

Human C5a (Complement Component 5a) CLIA Kit

Sign In for Pricing
View Details
Human C5a (Complement Component 5a) CLIA Kit
E-CL-H0174-03 96 Tests

Human C5a (Complement Component 5a) CLIA Kit

Sign In for Pricing
View Details
CLIC5 Rabbit Polyclonal Antibody
AP14238PU-N 400 µL

CLIC5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary
CS700403 5x 5 µm

Tissue FFPE Sections, Ovary

Sign In for Pricing
View Details
Scoparone
TRC-S199980-500MG 500 mg

Scoparone

Sign In for Pricing
View Details