Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DNAL1 Peptide - N-terminal region

DNAL1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C14orf168, MGC12435, CILD16

UniProt

Q4LDG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DNAL1 Rabbit Polyclonal Antibody (orb585261) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_113615

Preservative

Lyophilized powder

AA Sequence

TTIKEALARWEEKTGQRPSEAKEIKLYAQIPPIEKMDASLSMLANCEKLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Natriuretic Peptides B/NPPB Protein (His Tag)
PKSH033585-01 10 µg

Recombinant Human Natriuretic Peptides B/NPPB Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human Natriuretic Peptides B/NPPB Protein (His Tag)
PKSH033585-02 50 µg

Recombinant Human Natriuretic Peptides B/NPPB Protein (His Tag)

Sign In for Pricing
View Details
UBE3A (C-term) Rabbit Polyclonal Antibody
AP12054PU-N 400 µL

UBE3A (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Ethoxy-2-oxoethoxy Digoxigenin
TRC-E677980-250MG 250 mg

2-Ethoxy-2-oxoethoxy Digoxigenin

Sign In for Pricing
View Details
Vav2 Mouse Gene Knockout Kit (CRISPR)
KN518862 1 Kit

Vav2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Steviol Acyl Glucuronide Acetate
TRC-S686665-2.5MG 2.5 mg

Steviol Acyl Glucuronide Acetate

Sign In for Pricing
View Details