Dnmt1 Peptide - N-terminal region
Dnmt1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
Cxxc9, Dnmt, Dnmt1o, MTase, Met-1, Met1, MommeD2, MCMT, m.MmuI
UniProt
P13864
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Dnmt1 Rabbit Polyclonal Antibody (orb576188) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_034196
Preservative
Lyophilized powder
AA Sequence
SSVATRRTTRQTTITAHFTKGPTKRKPKEESEEGNSAESAAEERDQDKKR
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB2125-100 1x 100 µL
Ksp-Cadherin / CDH16 (Renal Cell Marker) (CDH16/2125), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![DR5 (TNFRSF10B) Mouse Monoclonal Antibody [Clone ID: OTI5G5]](https://cdn.genprice.uk/products/937/68dd18b9061270361e90804c/imageurl/cf807290.webp)
CF807290 100 µg
DR5 (TNFRSF10B) Mouse Monoclonal Antibody [Clone ID: OTI5G5]
Sign In for Pricing
View Details 
![beta Actin Recombinant Rabbit Monoclonal Antibody [PSH03-63]](https://cdn.genprice.uk/products/992/68dd1c8d061270361ea81e89/imageurl/ha722023.webp)
HA722023 100 µL
beta Actin Recombinant Rabbit Monoclonal Antibody [PSH03-63]
Sign In for Pricing
View Details