Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EFNA4 Peptide - N-terminal region

EFNA4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

EFL4, EPLG4, LERK4, MGC125826

UniProt

P52798

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EFNA4 Rabbit Polyclonal Antibody (orb585063) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_872632

Preservative

Lyophilized powder

AA Sequence

GPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ip6k2 siRNA Oligos set (Rat)
25023176 3x 5 nmol

Ip6k2 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Multiplex Assay Kit for Interferon Induced Transmembrane Protein 2 (IFITM2), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0031335 96 Tests

Multiplex Assay Kit for Interferon Induced Transmembrane Protein 2 (IFITM2), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
Disperse Orange 3 discontinued. See 273681
447416-01 2.5 g

Disperse Orange 3 discontinued. See 273681

Sign In for Pricing
View Details
Disperse Orange 3 discontinued. See 273681
447416-02 10 g

Disperse Orange 3 discontinued. See 273681

Sign In for Pricing
View Details
Mouse Serpin A1c/alpha-1-Antitrypsin Affinity Purified PAb
AF2979 100 µg

Mouse Serpin A1c/alpha-1-Antitrypsin Affinity Purified PAb

Sign In for Pricing
View Details
RAB41 Peptide - N-terminal region
orb2006757 100 µg

RAB41 Peptide - N-terminal region

Sign In for Pricing
View Details