Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAB41 Peptide - N-terminal region

RAB41 Peptide - N-terminal region

Product Specifications

UniProt

Q5JT25

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RAB41 Rabbit Polyclonal Antibody (orb586572) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001027898

Preservative

Lyophilized powder

AA Sequence

WMEAGGFGLEAAERTEYQSLCKSKLLFLGEQSGKTSIISRFMYNSFGCAC

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GUCA1C (GCAP3, Guanylyl Cyclase-activating Protein 3, Guanylate Cyclase Activator 1C) (MaxLight 405) discontinued
127669-ML405 100 µL

GUCA1C (GCAP3, Guanylyl Cyclase-activating Protein 3, Guanylate Cyclase Activator 1C) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Human LGR6/Leucine-rich repeat-containing G-protein coupled receptor 6 ELISA Kit
MBS2904908-01 48 Well

Human LGR6/Leucine-rich repeat-containing G-protein coupled receptor 6 ELISA Kit

Sign In for Pricing
View Details
Human LGR6/Leucine-rich repeat-containing G-protein coupled receptor 6 ELISA Kit
MBS2904908-02 96 Well

Human LGR6/Leucine-rich repeat-containing G-protein coupled receptor 6 ELISA Kit

Sign In for Pricing
View Details
Human LGR6/Leucine-rich repeat-containing G-protein coupled receptor 6 ELISA Kit
MBS2904908-03 5x 96 Well

Human LGR6/Leucine-rich repeat-containing G-protein coupled receptor 6 ELISA Kit

Sign In for Pricing
View Details
Human LGR6/Leucine-rich repeat-containing G-protein coupled receptor 6 ELISA Kit
MBS2904908-04 10x 96 Well

Human LGR6/Leucine-rich repeat-containing G-protein coupled receptor 6 ELISA Kit

Sign In for Pricing
View Details
Phospho-LKB1 (Thr363) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-1532R-BF680 100 µL

Phospho-LKB1 (Thr363) Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details