Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3K Peptide - C-terminal region

EIF3K Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARG134, EIF3-p28, EIF3S12, HSPC029, M9, MSTP001, PLAC-24, PLAC24, PRO1474, PTD001

UniProt

Q9UBQ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF3K Rabbit Polyclonal Antibody (orb331174) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037366

Preservative

Lyophilized powder

AA Sequence

AEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7, Mouse (HEK293, His)
HY-P72712-01 10 µg

CD7, Mouse (HEK293, His)

Sign In for Pricing
View Details
CD7, Mouse (HEK293, His)
HY-P72712-02 50 µg

CD7, Mouse (HEK293, His)

Sign In for Pricing
View Details
H-Trp-Asp-OH
G-3330.1000 1.0g

H-Trp-Asp-OH

Sign In for Pricing
View Details
E130003G02Rik Protein Vector (Mouse) (pPM-C-HA)
PV174040 500 ng

E130003G02Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Chicken Transcription Factor E2F7 (E2F7) ELISA Kit
MBS9359326 Inquire

Chicken Transcription Factor E2F7 (E2F7) ELISA Kit

Sign In for Pricing
View Details
TRADD Recombinant Antibody, PE-Cy5 Conjugated
bsm-61653R-PE-Cy5-01 20 µL

TRADD Recombinant Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details