CD7, Mouse (HEK293, His)
CD7 protein's functional role remains unclear, with its specific cellular activities and interactions, particularly with SECTM1, yet to be fully elucidated. Further research is essential for a comprehensive understanding of CD7 protein's functional significance and its potential involvement in various cellular processes. CD7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.
Product Specifications
Product Name Alternative
CD7 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/cd7-protein-mouse-hek-293-his.html
Purity
98.0
Smiles
QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFP
Molecular Formula
12516 (Gene_ID) P50283 (Q24-P150) (Accession)
Molecular Weight
18-30 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
HLA-DOA (HLA Class II Histocompatibility Antigen, DO alpha Chain, MHC DN-alpha, MHC DZ alpha, MHC Class II Antigen DOA, HLA-DNA, HLA-DZA) (MaxLight 550)
HLA-DOA (HLA Class II Histocompatibility Antigen, DO alpha Chain, MHC DN-alpha, MHC DZ alpha, MHC Class II Antigen DOA, HLA-DNA, HLA-DZA) (MaxLight 550)