Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD7, Mouse (HEK293, His)

CD7 protein's functional role remains unclear, with its specific cellular activities and interactions, particularly with SECTM1, yet to be fully elucidated. Further research is essential for a comprehensive understanding of CD7 protein's functional significance and its potential involvement in various cellular processes. CD7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd7-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFP

Molecular Formula

12516 (Gene_ID) P50283 (Q24-P150) (Accession)

Molecular Weight

18-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Frozen Tissue Sections, Thyroid gland
CS521031 5x 5 µm

Frozen Tissue Sections, Thyroid gland

Ask
View Details
Mouse GC-C Matched Antibody Pair Set [ABP-S-02904]
ABP-S-02904 5 Plates

Mouse GC-C Matched Antibody Pair Set [ABP-S-02904]

Ask
View Details
Rabbit Immunoglobulin A,IgA ELISA Kit
CN-00697R1 96T

Rabbit Immunoglobulin A,IgA ELISA Kit

Ask
View Details
Lentiviral mouse Arl6ip1 shRNA (UAS) - Lentiviral mouse Arl6ip1 shRNA (UAS, GFP) (100)
GTR15273237 1 Vial

Lentiviral mouse Arl6ip1 shRNA (UAS) - Lentiviral mouse Arl6ip1 shRNA (UAS, GFP) (100)

Ask
View Details
JHDM2a, CT (KDM3A, JHDM2A, JMJD1, JMJD1A, KIAA0742, TSGA, Lysine-specific demethylase 3A, JmjC domain-containing histone demethylation protein 2A, Jumonji domain-containing protein 1A) (MaxLight 750) discontinued
037192-ML750 100 µL

JHDM2a, CT (KDM3A, JHDM2A, JMJD1, JMJD1A, KIAA0742, TSGA, Lysine-specific demethylase 3A, JmjC domain-containing histone demethylation protein 2A, Jumonji domain-containing protein 1A) (MaxLight 750) discontinued

Ask
View Details
FGF21 Protein (N-Trx, Mouse)
P515160 100 µg

FGF21 Protein (N-Trx, Mouse)

Ask
View Details