Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD7, Mouse (HEK293, His)

CD7 protein's functional role remains unclear, with its specific cellular activities and interactions, particularly with SECTM1, yet to be fully elucidated. Further research is essential for a comprehensive understanding of CD7 protein's functional significance and its potential involvement in various cellular processes. CD7 Protein, Mouse (HEK293, His) is the recombinant mouse-derived CD7 protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

CD7 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd7-protein-mouse-hek-293-his.html

Purity

98.0

Smiles

QDVHQSPRLTIASEGDSVNITCSTRGHLEGILMKKIWPQAYNVIYFEDRQEPTVDRTFSGRINFSGSQKNLTITISSLQLADTGDYTCEAVRKVSARGLFTTVVVKEKSSQEAYRSQEPLQTSFSFP

Molecular Formula

12516 (Gene_ID) P50283 (Q24-P150) (Accession)

Molecular Weight

18-30 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
MBS2133301-01 0.1 mL

APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Ask
View Details
APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
MBS2133301-02 0.2 mL

APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Ask
View Details
APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
MBS2133301-03 0.5 mL

APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Ask
View Details
APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
MBS2133301-04 1 mL

APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Ask
View Details
APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
MBS2133301-05 5 mL

APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Ask
View Details
APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)
MBS2133301-06 5x 5 mL

APC_Cy7 Linked Monoclonal Antibody to Cluster Of Differentiation 147 (CD147)

Ask
View Details