Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETV2 Peptide - N-terminal region

ETV2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ER71, ETSRP71, MGC129834, MGC129835

UniProt

B5MD42

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ETV2 Rabbit Polyclonal Antibody (orb330260) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055024

Preservative

Lyophilized powder

AA Sequence

DTPTATAETCWKGTSSSLASFPQLDWGSALLHPEVPWGAEPDSQALPWSG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4- (1,3,4-oxadiazol-2-yl) benzoic acid
sc-347570 1 g

4- (1,3,4-oxadiazol-2-yl) benzoic acid

Sign In for Pricing
View Details
Chicken Intestinal Fatty Acid Binding Protein, iFABP ELISA Kit
MBS7264858-01 48 Well

Chicken Intestinal Fatty Acid Binding Protein, iFABP ELISA Kit

Sign In for Pricing
View Details
Chicken Intestinal Fatty Acid Binding Protein, iFABP ELISA Kit
MBS7264858-02 96 Well

Chicken Intestinal Fatty Acid Binding Protein, iFABP ELISA Kit

Sign In for Pricing
View Details
Chicken Intestinal Fatty Acid Binding Protein, iFABP ELISA Kit
MBS7264858-03 5x 96 Well

Chicken Intestinal Fatty Acid Binding Protein, iFABP ELISA Kit

Sign In for Pricing
View Details
Chicken Intestinal Fatty Acid Binding Protein, iFABP ELISA Kit
MBS7264858-04 10x 96 Well

Chicken Intestinal Fatty Acid Binding Protein, iFABP ELISA Kit

Sign In for Pricing
View Details
SARS-CoV-2 Spike RBD MAb (Clone 2847A)
MAB11198-100 100 µg

SARS-CoV-2 Spike RBD MAb (Clone 2847A)

Sign In for Pricing
View Details