Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Foxi2 Peptide - C-terminal region

Foxi2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

B130055A05Rik

UniProt

A2RTG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Foxi2 Rabbit Polyclonal Antibody (orb329929) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_899016

Preservative

Lyophilized powder

AA Sequence

FDNGNFRRKRRRRGETSEAAVPGASSPEGTALEPRGSTPQDPQTSPSPSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPA4 (NM_016352) Human Over-expression Lysate
LC402543 20 µg

CPA4 (NM_016352) Human Over-expression Lysate

Sign In for Pricing
View Details
PP2
SIH-470-25MG 25 mg

PP2

Sign In for Pricing
View Details
Recombinant Mouse Activin B protein (His Tag)
PKSM041500-01 20 µg

Recombinant Mouse Activin B protein (His Tag)

Sign In for Pricing
View Details
Recombinant Mouse Activin B protein (His Tag)
PKSM041500-02 100 µg

Recombinant Mouse Activin B protein (His Tag)

Sign In for Pricing
View Details
Bafilomycin A1
SIH-391-500UG 500 µg

Bafilomycin A1

Sign In for Pricing
View Details
L-Arginine Ethyl Ester Dihydrochloride
TRC-A769510-2.5G 2.5 g

L-Arginine Ethyl Ester Dihydrochloride

Sign In for Pricing
View Details