Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Frmd6 Peptide - middle region

Frmd6 Peptide - middle region

Product Specifications

Product Name Alternative

Frmd6

UniProt

Q8VII0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

XP_001064688

Preservative

Lyophilized powder

AA Sequence

ETDTKPRDPGPEDGYSGSVMHRKLKTCSSMTSHGSSHTSGVESGGKDRLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Epsin 3 Polyclonal Antibody
BS65369-01 50 µL

Epsin 3 Polyclonal Antibody

Sign In for Pricing
View Details
Epsin 3 Polyclonal Antibody
BS65369-02 100 µL

Epsin 3 Polyclonal Antibody

Sign In for Pricing
View Details
Frizzled 6 (FZD6) (NM_003506) Human Over-expression Lysate
LS008323 100 µg

Frizzled 6 (FZD6) (NM_003506) Human Over-expression Lysate

Sign In for Pricing
View Details
Deltorphin I
HY-P1336-01 5 mg

Deltorphin I

Sign In for Pricing
View Details
Deltorphin I
HY-P1336-02 10 mg

Deltorphin I

Sign In for Pricing
View Details
RpmF Antibody
orb826820 2 mg

RpmF Antibody

Sign In for Pricing
View Details