Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

AKR1D1 Peptide - middle region

AKR1D1 Peptide - middle region

Product Specifications

Product Name Alternative

3o5bred, CBAS2, SRD5B1

UniProt

P51857

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with AKR1D1 Rabbit Polyclonal Antibody (orb584809) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005980

Preservative

Lyophilized powder

AA Sequence

YVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COL21A1 Peptide - C-terminal region
orb2004474 100 µg

COL21A1 Peptide - C-terminal region

Sign In for Pricing
View Details
COX7A1 Antibody
E19-10098-1 50 µg - 50 µL

COX7A1 Antibody

Sign In for Pricing
View Details
GLRA1 sgRNA CRISPR Lentivector set (Human)
K0867301 3x 1.0 µg

GLRA1 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
MMP9 Recombinant Rabbit Monoclonal Antibody pair (detector)
orb2563245 100 µg

MMP9 Recombinant Rabbit Monoclonal Antibody pair (detector)

Sign In for Pricing
View Details
Duck M2-Cholinergic Receptor Antibodies ELISA Kit
MBS097119 Inquire

Duck M2-Cholinergic Receptor Antibodies ELISA Kit

Sign In for Pricing
View Details
FOXE1 Antibody
A43324-100UL 100 µL

FOXE1 Antibody

Sign In for Pricing
View Details