Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COL21A1 Peptide - C-terminal region

COL21A1 Peptide - C-terminal region

Product Specifications

UniProt

Q96P44

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COL21A1 Rabbit Polyclonal Antibody (orb585318) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGEPGYMGLPGIQGKKGDKGNQGEKGIQGQKGENGRQGIPGQQGIQGHHG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 alpha/Cd8a Rabbit Polyclonal Antibody (PE)
orb2613538 100 µg

CD8 alpha/Cd8a Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Mouse Repulsive guidance molecule A (RGMA) ELISA kit
GTR10449861 96 Well

Mouse Repulsive guidance molecule A (RGMA) ELISA kit

Sign In for Pricing
View Details
Luprostiol
HY-122399 1 Each

Luprostiol

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Ribosome-recycling factor (frr)
MBS1142174-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi A Ribosome-recycling factor (frr)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Ribosome-recycling factor (frr)
MBS1142174-02 0.1 mg (E-Coli)

Recombinant Salmonella paratyphi A Ribosome-recycling factor (frr)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Ribosome-recycling factor (frr)
MBS1142174-03 0.02 mg (Yeast)

Recombinant Salmonella paratyphi A Ribosome-recycling factor (frr)

Sign In for Pricing
View Details