Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Capsl Peptide - C-terminal region

Capsl Peptide - C-terminal region

Product Specifications

Product Name Alternative

RGD1308776, Capsl

UniProt

D4A6W9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Capsl Rabbit Polyclonal Antibody (orb325775) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001099887

Preservative

Lyophilized powder

AA Sequence

HHPKYQNGEWTEEQVFRKFLDNFDSPYDKDGLVTPEEFMNYYAGVSASID

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Zcrb1 activation kit by CRISPRa
GA207194 1 Kit

Mouse Zcrb1 activation kit by CRISPRa

Sign In for Pricing
View Details
PI 3 Kinase Class 3 Recombinant Rabbit Monoclonal Antibody [SY0286]
ET1607-74 100 µL

PI 3 Kinase Class 3 Recombinant Rabbit Monoclonal Antibody [SY0286]

Sign In for Pricing
View Details
Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
E-EL-H6066-01 24 Tests

Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
E-EL-H6066-02 48 Tests

Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit
E-EL-H6066-03 96 Tests

Human HIF-1α (Hypoxia Inducible Factor 1 Alpha) ELISA Kit

Sign In for Pricing
View Details
Tissue Total RNA, Pancreas
CR560275 5 µg

Tissue Total RNA, Pancreas

Sign In for Pricing
View Details