Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GLOD4 Peptide - N-terminal region

GLOD4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C17orf25, CGI-150, HC71

UniProt

D3DTG9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with GLOD4 Rabbit Polyclonal Antibody (orb583332) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057164

Preservative

Lyophilized powder

AA Sequence

EEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGVGDYKLGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASA2 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb2402851 100 µL

RASA2 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Ilorasertib hydrochloride
T11638 1 mg

Ilorasertib hydrochloride

Sign In for Pricing
View Details
Mouse Monoclonal Ctip1 Antibody (BCL11A/123) [mFluor Violet 500 SE]
NBP2-50115MFV500 0.1 mL

Mouse Monoclonal Ctip1 Antibody (BCL11A/123) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
CNTFR Antibody
GWB-MV817G 50 µg

CNTFR Antibody

Sign In for Pricing
View Details
NFkB/NFKB1 p105/p50 Rabbit Polyclonal Antibody (APC)
orb2623649 100 µg

NFkB/NFKB1 p105/p50 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
CTDSP1 (N-term) Rabbit Polyclonal Antibody
E10G32796 100 µL

CTDSP1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details