Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Gnmt Peptide - C-terminal region

Gnmt Peptide - C-terminal region

Product Specifications

UniProt

Q9QXF8

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Gnmt Rabbit Polyclonal Antibody (orb578867) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_034451

Preservative

Lyophilized powder

AA Sequence

FSKFRLSYYPHCLASFTELVRAAFGGRCQHSVLGDFKPYKPGQAYVPCYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse HP1α protein (His tag)
PDEM100278-01 20 µg

Recombinant Mouse HP1α protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse HP1α protein (His tag)
PDEM100278-02 100 µg

Recombinant Mouse HP1α protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse HP1α protein (His tag)
PDEM100278-03 500 µg

Recombinant Mouse HP1α protein (His tag)

Sign In for Pricing
View Details
Recombinant Mouse HP1α protein (His tag)
PDEM100278-04 1 mg

Recombinant Mouse HP1α protein (His tag)

Sign In for Pricing
View Details
Washc3 (NM_026070) Mouse Tagged ORF Clone
MG201887 10 µg

Washc3 (NM_026070) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Cytokeratin 8 (C-43), CF594 conjugate, 0.1mg/mL
BNC940688-100 1x 100 µL

Cytokeratin 8 (C-43), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details