Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GPT2 Peptide - C-terminal region

GPT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ALT2

UniProt

Q8TD30

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_597700

Preservative

Lyophilized powder

AA Sequence

PEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHPEIKGQLVKLLSVR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse mmu-miR-7025-3p miRNA Agomir
abx884109-01 5 nmol

Mouse mmu-miR-7025-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-7025-3p miRNA Agomir
abx884109-02 10 nmol

Mouse mmu-miR-7025-3p miRNA Agomir

Sign In for Pricing
View Details
LMO4 Recombinant Antibody
bsm-60672R-01 20 µL

LMO4 Recombinant Antibody

Sign In for Pricing
View Details
LMO4 Recombinant Antibody
bsm-60672R-02 100 µL

LMO4 Recombinant Antibody

Sign In for Pricing
View Details
ARNTL2 (Aryl Hydrocarbon Receptor Nuclear Translocator-like 2)
475646 100 µL

ARNTL2 (Aryl Hydrocarbon Receptor Nuclear Translocator-like 2)

Sign In for Pricing
View Details
Human ENPP-2 / Autotaxin Protein, His Tag (active enzyme)
EN2-H5241-50ug 50 µg

Human ENPP-2 / Autotaxin Protein, His Tag (active enzyme)

Sign In for Pricing
View Details