Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Grasp Peptide - N-terminal region

Grasp Peptide - N-terminal region

Product Specifications

Product Name Alternative

Tamalin

UniProt

Q9JJA9

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Grasp Rabbit Polyclonal Antibody (orb582064) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_062391

Preservative

Lyophilized powder

AA Sequence

FRWKNFTQSPEQQRKVLTLEKGDNQTFGFEIQTYGLHHREEQRVEMVTFV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human hsa-miR-4272 miRNA Antagomir
abx886310-01 10 nmol

Human hsa-miR-4272 miRNA Antagomir

Sign In for Pricing
View Details
Human hsa-miR-4272 miRNA Antagomir
abx886310-02 20 nmol

Human hsa-miR-4272 miRNA Antagomir

Sign In for Pricing
View Details
Prrxl1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV662757 1.0 µg DNA

Prrxl1 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Chromatic ESBL + AmpC
11629 20/Pack

Chromatic ESBL + AmpC

Sign In for Pricing
View Details
RPL28 Peptide - N-terminal region
orb2004993 100 µg

RPL28 Peptide - N-terminal region

Sign In for Pricing
View Details
Sheep Transcription factor p65, RELA ELISA KIT
JOT-EK0276Sh-01 96 Well

Sheep Transcription factor p65, RELA ELISA KIT

Sign In for Pricing
View Details