Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL28 Peptide - N-terminal region

RPL28 Peptide - N-terminal region

Product Specifications

Product Name Alternative

L28

UniProt

E9PB24

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL28 Rabbit Polyclonal Antibody (orb586326) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001129607

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LIHRKTVGVEPAADGKGVVVVIKRRSGQRKPATSYVRTTINKNARATLSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Chondrolectin Antibody (396305) [DyLight 405]
FAB2576E 0.1 mL

Mouse Monoclonal Chondrolectin Antibody (396305) [DyLight 405]

Sign In for Pricing
View Details
SFRP5 (FITC)
576131-01 50 µg

SFRP5 (FITC)

Sign In for Pricing
View Details
SFRP5 (FITC)
576131-02 100 µg

SFRP5 (FITC)

Sign In for Pricing
View Details
Lentiviral human EPM2A shRNA (UAS) - Lentiviral human EPM2A shRNA (UAS, iRFP) (100)
GTR15115767 1 Vial

Lentiviral human EPM2A shRNA (UAS) - Lentiviral human EPM2A shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
YTHDF3 (F-2) Alexa Fluor® 680
sc-377119 AF680 200 µg/mL

YTHDF3 (F-2) Alexa Fluor® 680

Sign In for Pricing
View Details
Lentiviral mouse Zfp385c shRNA (UAS) - Lentiviral mouse Zfp385c shRNA (UAS) (25)
GTR15245465 1 Vial

Lentiviral mouse Zfp385c shRNA (UAS) - Lentiviral mouse Zfp385c shRNA (UAS) (25)

Sign In for Pricing
View Details