Hao2 Peptide - middle region
Hao2 Peptide - middle region
Product Specifications
Product Name Alternative
AI325478, HAOX3, Hao3, Hao-2, Haox3
UniProt
Q9NYQ2
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Hao2 Rabbit Polyclonal Antibody (orb578063) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_062418
Preservative
Lyophilized powder
AA Sequence
IRGIIVSNHGGRQLDEVPASIDALREVVAAVNGKIEVYMDGGVRTGNDVL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
244250-Biotin 100 µL
CBFA2T2 (Core-Binding Factor, Runt Domain, alpha Subunit 2; Translocated to, 2, DKFZp313F2116, EHT, MTGR1, ZMYND3) (Biotin)
Sign In for Pricing
View Details 
orb1674814-01 20 µg
Recombinant Human rhinovirus 1B Genome polyprotein, partial
Sign In for Pricing
View Details orb1674814-02 100 µg
Recombinant Human rhinovirus 1B Genome polyprotein, partial
Sign In for Pricing
View Details orb1674814-03 1 mg
Recombinant Human rhinovirus 1B Genome polyprotein, partial
Sign In for Pricing
View Details