Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human rhinovirus 1B Genome polyprotein, partial

This Recombinant Human rhinovirus 1B Genome polyprotein, partial spans the amino acid sequence from region 2-332aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

(VP4-VP2) (P1A) (Virion protein 4) (P1B) (Virion protein 2) (P1C) (Virion protein 3) (P1D) (Virion protein 1) (P2A) (Picornain 2A) (Protein 2A) (P2B) (P2C) (P3A) (VPg) (Protein 3B) (P3B) (Picornain 3C) (P3C) (RdRp) (3D polymerase) (3Dpol) (Protein 3D) (3D)

UniProt

P12916

Expression Region

2-332aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Human rhinovirus 1B (HRV-1B)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GAQVSRQNVGTHSTQNSVSNGSSLNYFNINYFKDAASSGASRLDFSQDPSKFTDPVKDVLEKGIPTLQSPSVEACGYSDRIIQITRGDSTITSQDVANAVVGYGVWPHYLTPQDATAIDKPTQPDTSSNRFYTLESKHWNGDSKGWWWKLPDALKEMGIFGENMYYHFLGRSGYTVHVQCNASKFHQGTLLVAMIPEHQLASAKNGSVTAGYNLTHPGEAGRVVGQQRDANLRQPSDDSWLNFDGTLLGNLLIFPHQFINLRSNNSATLIVPYVNAVPMDSMLRHNNWSLVIIPISPLRSETTSSNIRPITVSISPMCAEFSGARAKNVRQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAPK1 Rabbit Monoclonal Antibody [Clone ID: 24GB3095]
TA424457 100 µL

MAPK1 Rabbit Monoclonal Antibody [Clone ID: 24GB3095]

Sign In for Pricing
View Details
OptiWell™ Automation Reservoirs
D3390-CVS 200 Units/Case

OptiWell™ Automation Reservoirs

Sign In for Pricing
View Details
Recombinant Human ORP150/HSP12A Protein (His Tag)
PKSH031144 50 µg

Recombinant Human ORP150/HSP12A Protein (His Tag)

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997UL-01 25 µg

Elab Fluor® 488 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997UL-02 100 µg

Elab Fluor® 488 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details
PRKACG Polyclonal Antibody
E-AB-90880-01 60 µL

PRKACG Polyclonal Antibody

Sign In for Pricing
View Details