Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HLA-E Peptide - middle region

HLA-E Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686P19218, EA1.2, EA2.1, HLA-6.2, MHC, QA1

UniProt

P13747

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HLA-E Rabbit Polyclonal Antibody (orb585438) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005507

Preservative

Lyophilized powder

AA Sequence

DTAAQISEQKSNDASEAEHQRAYLEDTCVEWLHKYLEKGKETLLHLEPPK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit
orb777502-01 48 Tests

Human Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit

Sign In for Pricing
View Details
Human Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit
orb777502-02 96 Tests

Human Quiescin Q6 Sulfhydryl Oxidase 1 (QSOX1) ELISA Kit

Sign In for Pricing
View Details
SETDB1 Peptide - N-terminal region
orb2004326 100 µg

SETDB1 Peptide - N-terminal region

Sign In for Pricing
View Details
Anti-ICER Antibody
CPA3875-01 30 µL

Anti-ICER Antibody

Sign In for Pricing
View Details
Anti-ICER Antibody
CPA3875-02 50 μL

Anti-ICER Antibody

Sign In for Pricing
View Details
Anti-ICER Antibody
CPA3875-03 100 µL

Anti-ICER Antibody

Sign In for Pricing
View Details