Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SETDB1 Peptide - N-terminal region

SETDB1 Peptide - N-terminal region

Product Specifications

UniProt

Q15047

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SETDB1 Rabbit Polyclonal Antibody (orb576925) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGCIGLDAATATVESEEIAELQQAVVEELGISMEELRHFIDEELEKMDCV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD80 Recombinant Rabbit monoclonal Antibody
HA723976 100 µL

CD80 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Human HORMAD2 activation kit by CRISPRa
GA115742 1 Kit

Human HORMAD2 activation kit by CRISPRa

Sign In for Pricing
View Details
CKMT1A Antibody
KC-6456-01 50 μL

CKMT1A Antibody

Sign In for Pricing
View Details
CKMT1A Antibody
KC-6456-02 100 µL

CKMT1A Antibody

Sign In for Pricing
View Details
CKMT1A Antibody
KC-6456-03 1 mL

CKMT1A Antibody

Sign In for Pricing
View Details
Human CXCL16 Antibody Pair Set
E-KAB-0541 50 µL & 100 µg

Human CXCL16 Antibody Pair Set

Sign In for Pricing
View Details