Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hpcal1 Peptide - C-terminal region

Hpcal1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NVP-3, Nvp3, VILIP3, Vnsl3, Vsnl3

UniProt

P62748

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Hpcal1 Rabbit Polyclonal Antibody (orb324751) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057886

Preservative

Lyophilized powder

AA Sequence

FSMYDLDGNGYISRSEMLEIVQAIYKMVSSVMKMPEDESTPEKRTDKIFR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cavy Tubulin Polymerization Promoting Protein ELISA Kit
MBS024794 Inquire

Cavy Tubulin Polymerization Promoting Protein ELISA Kit

Sign In for Pricing
View Details
YTHDC1 Peptide - N-terminal region
orb2007134 100 µg

YTHDC1 Peptide - N-terminal region

Sign In for Pricing
View Details
Canine Activating Transcription Factor 2 ELISA Kit
MBS016622-01 48 Well

Canine Activating Transcription Factor 2 ELISA Kit

Sign In for Pricing
View Details
Canine Activating Transcription Factor 2 ELISA Kit
MBS016622-02 96 Well

Canine Activating Transcription Factor 2 ELISA Kit

Sign In for Pricing
View Details
Canine Activating Transcription Factor 2 ELISA Kit
MBS016622-03 5x 96 Well

Canine Activating Transcription Factor 2 ELISA Kit

Sign In for Pricing
View Details
Canine Activating Transcription Factor 2 ELISA Kit
MBS016622-04 10x 96 Well

Canine Activating Transcription Factor 2 ELISA Kit

Sign In for Pricing
View Details