YTHDC1 Peptide - N-terminal region
YTHDC1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
KIAA1966, YT521, YT521-B
UniProt
Q96MU7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with YTHDC1 Rabbit Polyclonal Antibody (orb326571) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_588611
Preservative
Lyophilized powder
AA Sequence
GKSATEYKNEEYQRSERNKRLDADRKIRLSSSASREPYKNQPEKTCVRKR
More Discoveries
Explore Other Products
Browse additional items from our catalog
125911-PE 100 µL
DMRT1 (Doublesex and mab-3 Related Transcription Factor 1, DM Domain Expressed in Testis Protein 1, DMT1) (PE)
Sign In for Pricing
View Details 129493-ML750 100 µL
MCM2 (DNA Replication Licensing Factor MCM2, Minichromosome Maintenance Protein 2 Homolog, Nuclear Protein BM28, BM28, CCNL1, CDCL1, KIAA0030, MGC10606) (MaxLight 750) discontinued
Sign In for Pricing
View Details K3029106 1.0 µg DNA
Tdpoz5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details MBS2052190-01 0.1 mL
APC-Linked Polyclonal Antibody to Clusterin (CLU)
Sign In for Pricing
View Details