Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INPP5D Peptide - C-terminal region

INPP5D Peptide - C-terminal region

Product Specifications

Product Name Alternative

MGC104855, MGC142140, MGC142142, SHIP, SHIP1, SIP-145, hp51CN

UniProt

Q92835

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with INPP5D Rabbit Polyclonal Antibody (orb584877) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001017915

Preservative

Lyophilized powder

AA Sequence

PPTPTPRPPLPVKSPAVLHLQHSKGRDYRDNTELPHHGKHRPEEGPPGPL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAV1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B7]
TA804764AM 100 µL

SAV1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2B7]

Sign In for Pricing
View Details
FSH beta (5T6) Rabbit Monoclonal Antibody
E28M6579 100 µL

FSH beta (5T6) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
PDK4-IN-2
HY-157538 1 Each

PDK4-IN-2

Sign In for Pricing
View Details
Adenosine Receptor A2a Polyclonal Antibody, HRP Conjugated
bs-1456R-HRP-01 20 µL

Adenosine Receptor A2a Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Adenosine Receptor A2a Polyclonal Antibody, HRP Conjugated
bs-1456R-HRP-02 100 µL

Adenosine Receptor A2a Polyclonal Antibody, HRP Conjugated

Sign In for Pricing
View Details
Ugt1a5-set siRNA/shRNA/RNAi Lentivector (Mouse)
49116094 4x 500 ng

Ugt1a5-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details