Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRAK2 Peptide - C-terminal region

IRAK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

IRAK-2, MGC150550

UniProt

O43187

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IRAK2 Rabbit Polyclonal Antibody (orb584937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001561

Preservative

Lyophilized powder

AA Sequence

SSSEACVGLEPPQDVTETSWQIEINEAKRKLMENILLYKEEKVDSIELFG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG (Fcγ Fragment specific), AlpHcAbs® Goat antibody (HRP)
HA710064 100 µg

Human IgG (Fcγ Fragment specific), AlpHcAbs® Goat antibody (HRP)

Sign In for Pricing
View Details
2-Pyrimidin-4,6-d3-amine
TRC-A629257-5G 5 g

2-Pyrimidin-4,6-d3-amine

Sign In for Pricing
View Details
Tissue Total RNA, Bile duct
CR562523 5 µg

Tissue Total RNA, Bile duct

Sign In for Pricing
View Details
Human ATP10A activation kit by CRISPRa
GA111442 1 Kit

Human ATP10A activation kit by CRISPRa

Sign In for Pricing
View Details
NKX2-1 antibody
FNab09091 100 µg

NKX2-1 antibody

Sign In for Pricing
View Details
2,3,5-Trichlorobenzoic Acid
TRC-T774345-5G 5 g

2,3,5-Trichlorobenzoic Acid

Sign In for Pricing
View Details