Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITFG2 Peptide - middle region

ITFG2 Peptide - middle region

Product Specifications

Product Name Alternative

MDS028

UniProt

Q969R8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ITFG2 Rabbit Polyclonal Antibody (orb585445) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060933

Preservative

Lyophilized powder

AA Sequence

EGQVDSLSVTLGPLGLPELMVSQPGCAYAILLCTWKKDTGSPPASEGPTD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMP22 (Peripheral Myelin Protein 22, PMP-22, Growth Arrest-specific Protein 3, GAS-3, GAS3) (PE)
131518-PE 100 µL

PMP22 (Peripheral Myelin Protein 22, PMP-22, Growth Arrest-specific Protein 3, GAS-3, GAS3) (PE)

Sign In for Pricing
View Details
Anti-RRAS Mouse Monoclonal Antibody [Clone ID: OTI2B7]
M04310 100 µL

Anti-RRAS Mouse Monoclonal Antibody [Clone ID: OTI2B7]

Sign In for Pricing
View Details
Urocortin, human
M29720-01 100 mg

Urocortin, human

Sign In for Pricing
View Details
Urocortin, human
M29720-02 200 mg

Urocortin, human

Sign In for Pricing
View Details
Urocortin, human
M29720-03 500 mg

Urocortin, human

Sign In for Pricing
View Details
Urocortin, human
M29720-04 5 mg

Urocortin, human

Sign In for Pricing
View Details