Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KCNQ4 Peptide - middle region

KCNQ4 Peptide - middle region

Product Specifications

Product Name Alternative

DFNA2, KV7.4, DFNA2A

UniProt

P56696

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KCNQ4 Rabbit Polyclonal Antibody (orb329815) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004691

Preservative

Lyophilized powder

AA Sequence

SSRMGIKDRIRMGSSQRRTGPSKQHLAPPTMPTSPSSEQVGEATSPTKVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine LHB protein
orb246383-01 20 µg

Bovine LHB protein

Sign In for Pricing
View Details
Bovine LHB protein
orb246383-02 100 µg

Bovine LHB protein

Sign In for Pricing
View Details
Bovine LHB protein
orb246383-03 1 mg

Bovine LHB protein

Sign In for Pricing
View Details
General lipoteichoic acids (LTA) ELISA Kit
MBS2603054-01 48 Well

General lipoteichoic acids (LTA) ELISA Kit

Sign In for Pricing
View Details
General lipoteichoic acids (LTA) ELISA Kit
MBS2603054-02 96 Well

General lipoteichoic acids (LTA) ELISA Kit

Sign In for Pricing
View Details
General lipoteichoic acids (LTA) ELISA Kit
MBS2603054-03 5x 96 Well

General lipoteichoic acids (LTA) ELISA Kit

Sign In for Pricing
View Details