Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine LHB protein

This Bovine LHB protein spans the amino acid sequence from region 21-141aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LHB

UniProt

P04651

Expression Region

21-141aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 21-141aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TrkA/NTRK1 Antibody Picoband® Fluoro594 Conjugated
A00706-Fluoro594 100 µg/Vial

Anti-TrkA/NTRK1 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
Recombinant E.coli Inositol-1-monophosphatase
OPCA00758-100UG 100 µg

Recombinant E.coli Inositol-1-monophosphatase

Sign In for Pricing
View Details
Integrin alpha6 (VLA6, alpha6, beta1, alpha6 beta4, Laminin Receptors) (MaxLight 650)
MBS6246507-01 0.1 mL

Integrin alpha6 (VLA6, alpha6, beta1, alpha6 beta4, Laminin Receptors) (MaxLight 650)

Sign In for Pricing
View Details
Integrin alpha6 (VLA6, alpha6, beta1, alpha6 beta4, Laminin Receptors) (MaxLight 650)
MBS6246507-02 5x 0.1 mL

Integrin alpha6 (VLA6, alpha6, beta1, alpha6 beta4, Laminin Receptors) (MaxLight 650)

Sign In for Pricing
View Details
PEX26 Protein Lysate
OCOA18545-20UG 20 µg

PEX26 Protein Lysate

Sign In for Pricing
View Details
3-Chloro-2,5-difluorobenzoic acid
PC1009935-01 250 mg

3-Chloro-2,5-difluorobenzoic acid

Sign In for Pricing
View Details