Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KIFAP3 Peptide - middle region

KIFAP3 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ22818, KAP3, SMAP, Smg-GDS, dJ190I16.1, KAP-3

UniProt

Q92845

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KIFAP3 Rabbit Polyclonal Antibody (orb582644) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055785

Preservative

Lyophilized powder

AA Sequence

WLEMVESRQMDESEQYLYGDDRIEPYIHEGDILERPDLFYNSDGLIASEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myoglobin (MB) Antibody
abx170018-01 100 µL

Myoglobin (MB) Antibody

Sign In for Pricing
View Details
Myoglobin (MB) Antibody
abx170018-02 200 µL

Myoglobin (MB) Antibody

Sign In for Pricing
View Details
Myoglobin (MB) Antibody
abx170018-03 1 mL

Myoglobin (MB) Antibody

Sign In for Pricing
View Details
Copper histidine
orb1745202-01 1 mg

Copper histidine

Sign In for Pricing
View Details
Copper histidine
orb1745202-02 5 mg

Copper histidine

Sign In for Pricing
View Details
Copper histidine
orb1745202-03 10 mg

Copper histidine

Sign In for Pricing
View Details