Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

L3mbtl Peptide - middle region

L3mbtl Peptide - middle region

Product Specifications

Product Name Alternative

C630004G01, KIAA0681, L3MBTL1, mKIAA0681, L3mbtl

UniProt

A2A5N8

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with L3mbtl Rabbit Polyclonal Antibody (orb576369) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_900202

Preservative

Lyophilized powder

AA Sequence

LKPMKKRKHKEYQSPSEESEPEAVKQGEGKDAEREPTPSTPENEEWSRSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CALmL5 (NM_017422) Human Over-expression Lysate
LC413780 20 µg

CALmL5 (NM_017422) Human Over-expression Lysate

Sign In for Pricing
View Details
TAG-72 / CA72.4 (B72.3), CF594 conjugate, 0.1mg/mL
BNC940276-500 1x 500 µL

TAG-72 / CA72.4 (B72.3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CSMD3 ORF Vector (Human) (pORF)
16930011 1.0 µg DNA

CSMD3 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
GAK Antibody
33573-01 50 µL

GAK Antibody

Sign In for Pricing
View Details
GAK Antibody
33573-02 100 µL

GAK Antibody

Sign In for Pricing
View Details
Terbuthylazine
orb1708380-01 50 mg

Terbuthylazine

Sign In for Pricing
View Details