Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LHPP Peptide - middle region

LHPP Peptide - middle region

Product Specifications

Product Name Alternative

MGC117251, MGC142189, MGC142191, HDHD2B

UniProt

Q9H008

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LHPP Rabbit Polyclonal Antibody (orb326217) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071409

Preservative

Lyophilized powder

AA Sequence

ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lubabegron fumarate
orb1740174-01 25 mg

Lubabegron fumarate

Sign In for Pricing
View Details
Lubabegron fumarate
orb1740174-02 50 mg

Lubabegron fumarate

Sign In for Pricing
View Details
Lubabegron fumarate
orb1740174-03 100 mg

Lubabegron fumarate

Sign In for Pricing
View Details
Anti-Cd19 Antibody , APC Conjugate
A00154-4-APC 100 µg/Vial

Anti-Cd19 Antibody , APC Conjugate

Sign In for Pricing
View Details
Kras4B G12D-IN-1
HY-153413-01 5 mg

Kras4B G12D-IN-1

Sign In for Pricing
View Details
Kras4B G12D-IN-1
HY-153413-02 10 mM - 1 mL

Kras4B G12D-IN-1

Sign In for Pricing
View Details