Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LRAT Peptide - N-terminal region

LRAT Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC33103, LCA14

UniProt

O95237

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LRAT Rabbit Polyclonal Antibody (orb584453) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004735

Preservative

Lyophilized powder

AA Sequence

LEVPRTHLTHYGIYLGDNRVAHMMPDILLALTDDMGRTQKVVSNKRLILG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF2B5 Recombinant Rabbit Monoclonal Antibody [JE34-98]
HA722206 100 µL

EIF2B5 Recombinant Rabbit Monoclonal Antibody [JE34-98]

Sign In for Pricing
View Details
SEC11C Human Gene Knockout Kit (CRISPR)
KN402122 1 Kit

SEC11C Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Pyridoxine-d2 Hydrochloride
TRC-P991734-1MG 1 mg

Pyridoxine-d2 Hydrochloride

Sign In for Pricing
View Details
14-3-3 sigma (SFN) (NM_006142) Human Recombinant Protein
TP720151M 50 µg

14-3-3 sigma (SFN) (NM_006142) Human Recombinant Protein

Sign In for Pricing
View Details
DPM1 (NM_003859) Human Over-expression Lysate
LY401268 100 µg

DPM1 (NM_003859) Human Over-expression Lysate

Sign In for Pricing
View Details
Aquaporin 4 Recombinant Rabbit Monoclonal Antibody [JE59-76]
HA721954 100 µL

Aquaporin 4 Recombinant Rabbit Monoclonal Antibody [JE59-76]

Sign In for Pricing
View Details