Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAGOHB Peptide - C-terminal region

MAGOHB Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ10292, MGN2, mago, magoh

UniProt

Q96A72

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAGOHB Rabbit Polyclonal Antibody (orb585392) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060518

Preservative

Lyophilized powder

AA Sequence

LWPPPDRVGRQELEIVIGDEHISFTTSKIGSLIDVNQSKDPEGLRVFYYL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP1 (NM_032682) Human Over-expression Lysate
LC403191 20 µg

FOXP1 (NM_032682) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human PAP protein (His tag)
PDEH100831-01 20 µg

Recombinant Human PAP protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PAP protein (His tag)
PDEH100831-02 100 µg

Recombinant Human PAP protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PAP protein (His tag)
PDEH100831-03 500 µg

Recombinant Human PAP protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PAP protein (His tag)
PDEH100831-04 1 mg

Recombinant Human PAP protein (His tag)

Sign In for Pricing
View Details
Human RNF182 activation kit by CRISPRa
GA116633 1 Kit

Human RNF182 activation kit by CRISPRa

Sign In for Pricing
View Details