Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK13 Peptide - middle region

MAPK13 Peptide - middle region

Product Specifications

Product Name Alternative

MGC99536, PRKM13, SAPK4, p38delta

UniProt

Q9N272

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MAPK13 Rabbit Polyclonal Antibody (orb583160) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002745

Preservative

Lyophilized powder

AA Sequence

EMLTGKTLFKGKDYLDQLTQILKVTGVPGTEFVQKLNDKAAKSYIQSLPQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myosin, Light Chain (Biotin) discontinued
M9850-02B-Biotin 100 µL

Myosin, Light Chain (Biotin) discontinued

Sign In for Pricing
View Details
JUN Peptide - N-terminal region
orb1998016 100 µg

JUN Peptide - N-terminal region

Sign In for Pricing
View Details
TMM79, CT (TMEM79, Transmembrane protein 79) (MaxLight 650)
MBS6356600-01 0.1 mL

TMM79, CT (TMEM79, Transmembrane protein 79) (MaxLight 650)

Sign In for Pricing
View Details
TMM79, CT (TMEM79, Transmembrane protein 79) (MaxLight 650)
MBS6356600-02 5x 0.1 mL

TMM79, CT (TMEM79, Transmembrane protein 79) (MaxLight 650)

Sign In for Pricing
View Details
ARFGEF2 monoclonal antibody
orb1724545-01 50 µL

ARFGEF2 monoclonal antibody

Sign In for Pricing
View Details
ARFGEF2 monoclonal antibody
orb1724545-02 100 µL

ARFGEF2 monoclonal antibody

Sign In for Pricing
View Details