Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JUN Peptide - N-terminal region

JUN Peptide - N-terminal region

Product Specifications

Product Name Alternative

AP1, AP-1, c-Jun

UniProt

P05412

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

NCBI Accession Number

NP_002219.1

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLTSPDVGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLS3 Protein Vector (Mouse) (pPB-N-His)
PV217299 500 ng

PLS3 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Gavestinel
B7029-1 1 mg

Gavestinel

Sign In for Pricing
View Details
Recombinant BVDV NS3/p80 Protein, N-His
orb2830980-01 20 µg

Recombinant BVDV NS3/p80 Protein, N-His

Sign In for Pricing
View Details
Recombinant BVDV NS3/p80 Protein, N-His
orb2830980-02 50 µg

Recombinant BVDV NS3/p80 Protein, N-His

Sign In for Pricing
View Details
Recombinant BVDV NS3/p80 Protein, N-His
orb2830980-03 100 µg

Recombinant BVDV NS3/p80 Protein, N-His

Sign In for Pricing
View Details
ErbB 4 Rabbit Polyclonal Antibody (BF647)
orb2451102 100 µL

ErbB 4 Rabbit Polyclonal Antibody (BF647)

Sign In for Pricing
View Details