Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MASTL Peptide - C-terminal region

MASTL Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ14813, RP11-85G18.2, THC2, GW, GWL, hGWL, MAST-L, GREATWALL

UniProt

Q96GX5

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_116233

Preservative

Lyophilized powder

AA Sequence

NKENIVNSFTDKQQTPEKLPIPMIAKNLMCELDEDCEKNSKRDYLSSSFL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ku70 Mouse Monoclonal Antibody [D1-A6]
EM50109 100 µL

Ku70 Mouse Monoclonal Antibody [D1-A6]

Sign In for Pricing
View Details
Thymidine Kinase cytosolic (TK1) Chicken ELISA Kit
H5980 96 Tests

Thymidine Kinase cytosolic (TK1) Chicken ELISA Kit

Sign In for Pricing
View Details
PLV3-U6-CACNA1C-sgRNA2-Cas9-EGFP-Puro Plasmid
PVT82706 2 µg

PLV3-U6-CACNA1C-sgRNA2-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
Recombinant Pasteurella Multocida cmoA Protein (aa 1-241)
VAng-Cr6745-500gEcoli 500 µg (E. coli)

Recombinant Pasteurella Multocida cmoA Protein (aa 1-241)

Sign In for Pricing
View Details
Complement factor D-IN-1 50mg
A20253-50 50 mg

Complement factor D-IN-1 50mg

Sign In for Pricing
View Details
Recombinant Human AGO2/Argonaute 2/EIF2C2 Protein (His Tag)(Active)
MBS2545928-01 0.1 mg

Recombinant Human AGO2/Argonaute 2/EIF2C2 Protein (His Tag)(Active)

Sign In for Pricing
View Details