Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPL49 Peptide - N-terminal region

MRPL49 Peptide - N-terminal region

Product Specifications

Product Name Alternative

C11orf4, L49mt, MGC10656, NOF, NOF1, MRP-L49

UniProt

Q13405

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MRPL49 Rabbit Polyclonal Antibody (orb584564) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004918

Preservative

Lyophilized powder

AA Sequence

IMVTFRNQASRPYSFYSSLISYEEDQRQGAEPRKNFVKPNETKTYFWKVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wfdc10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
50397114 3x 1.0 µg

Wfdc10 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Ac-[Lys0, Nle3]-Gamma2-MSH amide
orb364133-01 1 mg

Ac-[Lys0, Nle3]-Gamma2-MSH amide

Sign In for Pricing
View Details
Ac-[Lys0, Nle3]-Gamma2-MSH amide
orb364133-02 5 mg

Ac-[Lys0, Nle3]-Gamma2-MSH amide

Sign In for Pricing
View Details
Ac-[Lys0, Nle3]-Gamma2-MSH amide
orb364133-03 10 mg

Ac-[Lys0, Nle3]-Gamma2-MSH amide

Sign In for Pricing
View Details
Recombinant human DUSP10 protein
ATGP1392-100 100 µg

Recombinant human DUSP10 protein

Sign In for Pricing
View Details
Nitrated α/β-synuclein (Syn12) : m-IgG1 BP-HRP Bundle
sc-541149 1 Kit

Nitrated α/β-synuclein (Syn12) : m-IgG1 BP-HRP Bundle

Sign In for Pricing
View Details