Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Nfkbiz Peptide - C-terminal region

Nfkbiz Peptide - C-terminal region

Product Specifications

Product Name Alternative

AA408868, INAP, Mail

UniProt

Q9EST8

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Nfkbiz Rabbit Polyclonal Antibody (orb583661) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_085115

Preservative

Lyophilized powder

AA Sequence

VRLLMRKGADPSTRNLENEQPVHLVPDGPVGEQIRRILKGKSIQQRAPPY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Mitofusin-1 (Mfn1), partial
MBS7095327 Inquire

Recombinant Rat Mitofusin-1 (Mfn1), partial

Sign In for Pricing
View Details
KRT18 Antibody - N-terminal region : Biotin (ARP40205_T100-Biotin)
ARP40205_T100-Biotin 100 µL

KRT18 Antibody - N-terminal region : Biotin (ARP40205_T100-Biotin)

Sign In for Pricing
View Details
Recombinant Chlamydophila Trachomatis gap Protein (aa 1-334)
VAng-Lsx6706-500gEcoli 500 µg (E. coli)

Recombinant Chlamydophila Trachomatis gap Protein (aa 1-334)

Sign In for Pricing
View Details
H-DL-Trp-OMe · HCl
F-3435.0005 5.0g

H-DL-Trp-OMe · HCl

Sign In for Pricing
View Details
Anti-HUR Antibody
MBS820489-01 0.03 mL

Anti-HUR Antibody

Sign In for Pricing
View Details
Anti-HUR Antibody
MBS820489-02 0.05 mL

Anti-HUR Antibody

Sign In for Pricing
View Details